Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small ubiquitin-related modifier 5 (SUMO5)

This Recombinant Human Small ubiquitin-related modifier 5 (SUMO5) spans the amino acid sequence from region 1-97. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small ubiquitin-related modifier 5; SUMO-5; SUMO1 pseudogene 1; Ubiquitin-like 2; Ubiquitin-like 6; SUMO1P1 SUMO5 UBL2 UBL6

UniProt

G2XKQ0

Expression Region

1-97

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSDLEAKPSTEHLGDKIKDEDIKLRVIGQDSSEIHFKVKMTTPLKKLKKSYCQRQGVPVNSLRFLFEGQRIADNHTPEELGMEEEDVIEVYQEQIGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pigeon Discs, Large Homolog 3 ELISA Kit
MBS085261 Inquire

Pigeon Discs, Large Homolog 3 ELISA Kit

Sign In for Pricing
View Details
ALB Rabbit Monoclonal Antibody [Clone ID: D1]
TA386099 200 µg

ALB Rabbit Monoclonal Antibody [Clone ID: D1]

Sign In for Pricing
View Details
ALKBH7 (NM_032306) Human Mass Spec Standard
PH302583 10 µg

ALKBH7 (NM_032306) Human Mass Spec Standard

Sign In for Pricing
View Details
NAA16 Adenovirus (Human)
31368051 1.0 mL

NAA16 Adenovirus (Human)

Sign In for Pricing
View Details
Guanine Nucleotide Binding Protein (G Protein), Beta Polypeptide 2 (GNB2) Antibody
abx112892 100 µL

Guanine Nucleotide Binding Protein (G Protein), Beta Polypeptide 2 (GNB2) Antibody

Sign In for Pricing
View Details
Olr1562 ORF Vector (Rat) (pORF)
34039016 1.0 µg DNA

Olr1562 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details