Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 250 (TM250), partial

This Recombinant Human Transmembrane protein 250 (TM250), partial spans the amino acid sequence from region 1-55. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 250; Herpes virus UL25-binding protein; TMEM250 C9orf69

UniProt

H0YL14

Expression Region

1-55

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPVMPIPRRVRSFHGPHTTCLHAACGPVRASHLARTKYNNFDVYIKTRWLYGFIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PICK1 Mouse Monoclonal Antibody [Clone ID: L20/8]
75-040 100 µL

PICK1 Mouse Monoclonal Antibody [Clone ID: L20/8]

Sign In for Pricing
View Details
WDR61 Mouse Monoclonal Antibody [Clone ID: OTI1A7]
CF807589 100 µg

WDR61 Mouse Monoclonal Antibody [Clone ID: OTI1A7]

Sign In for Pricing
View Details
JAmL (NM_001098526) Human Recombinant Protein
TP318818M 100 µg

JAmL (NM_001098526) Human Recombinant Protein

Sign In for Pricing
View Details
Pentachloronitrobenzene
TRC-P237990-25G 25 g

Pentachloronitrobenzene

Sign In for Pricing
View Details
Uncoated Porcine IL-4 (Interleukin 4) ELISA Kit
E-UNEL-P0009-01 5x 96 Tests

Uncoated Porcine IL-4 (Interleukin 4) ELISA Kit

Sign In for Pricing
View Details
Uncoated Porcine IL-4 (Interleukin 4) ELISA Kit
E-UNEL-P0009-02 15x 96 Tests

Uncoated Porcine IL-4 (Interleukin 4) ELISA Kit

Sign In for Pricing
View Details