Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 250 (TM250), partial

This Recombinant Human Transmembrane protein 250 (TM250), partial spans the amino acid sequence from region 1-55. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 250; Herpes virus UL25-binding protein; TMEM250 C9orf69

UniProt

H0YL14

Expression Region

1-55

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPVMPIPRRVRSFHGPHTTCLHAACGPVRASHLARTKYNNFDVYIKTRWLYGFIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human INO80B shRNA (UAS) - Lentiviral human INO80B shRNA (UAS, RFP) (100)
GTR15102708 1 Vial

Lentiviral human INO80B shRNA (UAS) - Lentiviral human INO80B shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Clinical 4-Way Rack Purple PK5
RAC0028 5 / PCK

Clinical 4-Way Rack Purple PK5

Sign In for Pricing
View Details
MTOR Human shRNA Plasmid Kit (Locus ID 2475)
TF320364 1 Kit

MTOR Human shRNA Plasmid Kit (Locus ID 2475)

Sign In for Pricing
View Details
Mouse Monoclonal Phosphoribosyl Pyrophosphate Amidotransferase Antibody (OTI1B11) [Alexa Fluor 594]
NBP2-73393AF594 0.1 mL

Mouse Monoclonal Phosphoribosyl Pyrophosphate Amidotransferase Antibody (OTI1B11) [Alexa Fluor 594]

Sign In for Pricing
View Details
Diosmetin
C16808-20mg 20 mg

Diosmetin

Sign In for Pricing
View Details
APC/XFD750 Anti-human CD116 Antibody *4H1*
111601D0-AAT 25 Tests

APC/XFD750 Anti-human CD116 Antibody *4H1*

Sign In for Pricing
View Details