Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 22 (SIM22), partial

This Recombinant Human Small integral membrane protein 22 (SIM22), partial spans the amino acid sequence from region 1-31. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 22; Cancer-associated small integral membrane open reading frame 1; SMIM22 CASIMO1

UniProt

K7EJ46

Expression Region

1-31

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAVSTEELEATVQEVLGRLKSHQFFQSTWDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tebufenozide
TRC-T013200-250MG 250 mg

Tebufenozide

Sign In for Pricing
View Details
ZNF19 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10C3]
TA811266BM 100 µL

ZNF19 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10C3]

Sign In for Pricing
View Details
ST8SIA1 (NM_003034) Human Over-expression Lysate
LY401062 100 µg

ST8SIA1 (NM_003034) Human Over-expression Lysate

Sign In for Pricing
View Details
Stability Test Chamber BTST-1510
BTST-1510 1 Unit

Stability Test Chamber BTST-1510

Sign In for Pricing
View Details
PLP2 Human Gene Knockout Kit (CRISPR)
KN422024 1 Kit

PLP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human ProS1 Protein, His Tag
PR1-H52H4-100ug 100 µg

Human ProS1 Protein, His Tag

Sign In for Pricing
View Details