Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cystatin-C (CYTC)

This Recombinant Human Cystatin-C (CYTC) spans the amino acid sequence from region 27-146. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cystatin-C; Cystatin-3; Gamma-trace; Neuroendocrine basic polypeptide; Post-gamma-globulin; CST3

UniProt

P01034

Expression Region

27-146

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSK3145095
BA3501-5.1 1 mL (10 mM in DMSO)

GSK3145095

Sign In for Pricing
View Details
C9orf93 Polyclonal Antibody, Cy5.5 Conjugated
bs-15348R-Cy5.5 100 µL

C9orf93 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal SGOL2 Antibody [Alexa Fluor 700]
NB100-60454AF700 0.1 mL

Rabbit Polyclonal SGOL2 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
INPP5E peptide
orb218936-01 1 mg

INPP5E peptide

Sign In for Pricing
View Details
INPP5E peptide
orb218936-02 5 mg

INPP5E peptide

Sign In for Pricing
View Details
CGB7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0440006 1.0 µg DNA

CGB7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details