Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cystatin-C (CYTC)

This Recombinant Human Cystatin-C (CYTC) spans the amino acid sequence from region 27-146. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cystatin-C; Cystatin-3; Gamma-trace; Neuroendocrine basic polypeptide; Post-gamma-globulin; CST3

UniProt

P01034

Expression Region

27-146

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lighting Incubator
LX100LI 1 Unit

Lighting Incubator

Sign In for Pricing
View Details
SNRPA Antibody
orb681399 100 µL

SNRPA Antibody

Sign In for Pricing
View Details
Mouse Monoclonal SETD7/9 Antibody (s4E5) [DyLight 594]
NBP1-04298DL594 0.1 mL

Mouse Monoclonal SETD7/9 Antibody (s4E5) [DyLight 594]

Sign In for Pricing
View Details
RNH1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
40327062 1.0 µg DNA

RNH1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant Human Inositol 1,4,5-Trisphosphate 5-Phosphatase/INPP5A (C-6His)
CI49-500ug 500 µg

Recombinant Human Inositol 1,4,5-Trisphosphate 5-Phosphatase/INPP5A (C-6His)

Sign In for Pricing
View Details
Anti-Human IFITM5 Polyclonal Antibody
HT338014-01 50 µg

Anti-Human IFITM5 Polyclonal Antibody

Sign In for Pricing
View Details