Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cystatin-C (CYTC)

This Recombinant Human Cystatin-C (CYTC) spans the amino acid sequence from region 27-146. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cystatin-C; Cystatin-3; Gamma-trace; Neuroendocrine basic polypeptide; Post-gamma-globulin; CST3

UniProt

P01034

Expression Region

27-146

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-34 ELISA Kit (Human) : 96 Wells (OKAG00148)
OKAG00148 96 Well

IL-34 ELISA Kit (Human) : 96 Wells (OKAG00148)

Sign In for Pricing
View Details
NARG1 Lentiviral Activation Particles (h2)
sc-405520-LAC-2 200 µL

NARG1 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Human PRR15L activation kit by CRISPRa
GA112399 1 Kit

Human PRR15L activation kit by CRISPRa

Sign In for Pricing
View Details
CCDC144A Rabbit Polyclonal Antibody (PE)
orb497109 100 µL

CCDC144A Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
C1orf129 Polyclonal Antibody, FITC Conjugated
bs-9778R-FITC 100 µL

C1orf129 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
PAK5 Peptide
3075P 0.05 mg

PAK5 Peptide

Sign In for Pricing
View Details