Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vasopressin-neurophysin 2-copeptin (NEU2), partial

This Recombinant Human Vasopressin-neurophysin 2-copeptin (NEU2), partial spans the amino acid sequence from region 32-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vasopressin-neurophysin 2-copeptin; AVP-NPII; [Cleaved into: Arg-vasopressin; Arginine-vasopressin; Neurophysin 2; Neurophysin-II; Copeptin] AVP ARVP VP

UniProt

P01185

Expression Region

32-124

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AMSDLELRQCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAAFGVCCNDESCVTEPECREGFHRRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein Tyrosine Phosphatase Receptor Type O (PTPRO) Antibody
abx236946 100 µg

Protein Tyrosine Phosphatase Receptor Type O (PTPRO) Antibody

Sign In for Pricing
View Details
Mouse Monoclonal CD38 Antibody (1G7F4) [Biotin]
NBP2-25265B 0.1 mL

Mouse Monoclonal CD38 Antibody (1G7F4) [Biotin]

Sign In for Pricing
View Details
Human DLL3 (353-492) Protein
orb1152435-01 100 µg

Human DLL3 (353-492) Protein

Sign In for Pricing
View Details
Human DLL3 (353-492) Protein
orb1152435-02 1 mg

Human DLL3 (353-492) Protein

Sign In for Pricing
View Details
HS3ST3B1 CRISPR/Cas9 KO Plasmid (h)
sc-409765 20 µg

HS3ST3B1 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
2’-Deoxy-2’-fluoroadenosine-3’-CE-phosphoramidite
BIMN2018 1 g

2’-Deoxy-2’-fluoroadenosine-3’-CE-phosphoramidite

Sign In for Pricing
View Details