Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glycoprotein hormones alpha chain (GLHA)

This Recombinant Human Glycoprotein hormones alpha chain (GLHA) spans the amino acid sequence from region 25-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glycoprotein hormones alpha chain; Anterior pituitary glycoprotein hormones common subunit alpha; Choriogonadotropin alpha chain; Chorionic gonadotrophin subunit alpha; CG-alpha; Follicle-stimulating hormone alpha chain; FSH-alpha; Follitropin alpha chain; Luteinizing hormone alpha chain; LSH-alpha; Lutropin alpha chain; Thyroid-stimulating hormone alpha chain; TSH-alpha; Thyrotropin alpha chain; CGA

UniProt

P01215

Expression Region

25-116

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Semaphorin 6A Affinity Purified Polyclonal Ab
AF1146-SP 25 µg

Human Semaphorin 6A Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
FAM107A (NM_001076778) Human Recombinant Protein
E45H40164M5 20 µg

FAM107A (NM_001076778) Human Recombinant Protein

Sign In for Pricing
View Details
Rps29 (NM_009093) Mouse Tagged ORF Clone
MG223802 10 µg

Rps29 (NM_009093) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
NOS III, NT (Endothelial Nitric Oxide Synthase, eNOS, NOS 3) discontinued, see N5350-23D
E3218-01A 100 µL

NOS III, NT (Endothelial Nitric Oxide Synthase, eNOS, NOS 3) discontinued, see N5350-23D

Sign In for Pricing
View Details
Actin-Related protein 2/3 complex subunit 1A (ARPC1A) Mouse ELISA Kit
B2352 96 Tests

Actin-Related protein 2/3 complex subunit 1A (ARPC1A) Mouse ELISA Kit

Sign In for Pricing
View Details
EGFR, phosphorylated (Y1092) (Epidermal Growth Factor Receptor, ERBB, ERBB1, HER1, PIG61, MENA) discontinued
210614-01 50 µL

EGFR, phosphorylated (Y1092) (Epidermal Growth Factor Receptor, ERBB, ERBB1, HER1, PIG61, MENA) discontinued

Sign In for Pricing
View Details