Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glycophorin-A (GLPA), partial

This Recombinant Human Glycophorin-A (GLPA), partial spans the amino acid sequence from region 20-91. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glycophorin-A; MN sialoglycoprotein; PAS-2; Sialoglycoprotein alpha; CD antigen CD235a; GYPA GPA MNS

UniProt

P02724

Expression Region

20-91

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oaz1 (BC094287) Mouse Tagged ORF Clone
MG200056 10 µg

Oaz1 (BC094287) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Laminin 2 alpha Recombinant Rabbit Monoclonal Antibody [PSH0-94]
HA721532 100 µL

Laminin 2 alpha Recombinant Rabbit Monoclonal Antibody [PSH0-94]

Sign In for Pricing
View Details
Fmoc-D-Ala TentaGel® S AC Resin
SAD1101.1G 1 g

Fmoc-D-Ala TentaGel® S AC Resin

Sign In for Pricing
View Details
Recombinant Mucin 5AC Antibody
RC-16885-01 50 μL

Recombinant Mucin 5AC Antibody

Sign In for Pricing
View Details
Recombinant Mucin 5AC Antibody
RC-16885-02 100 µL

Recombinant Mucin 5AC Antibody

Sign In for Pricing
View Details
Recombinant Mucin 5AC Antibody
RC-16885-03 1 mL

Recombinant Mucin 5AC Antibody

Sign In for Pricing
View Details