Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Osteocalcin (OSTCN)

This Recombinant Human Osteocalcin (OSTCN) spans the amino acid sequence from region 52-100. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Osteocalcin; Bone Gla protein; BGP; Gamma-carboxyglutamic acid-containing protein; BGLAP

UniProt

P02818

Expression Region

52-100

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCL2 (Adenovirus E1B 19kD protein-interacting protein 3, NIP3/BNIP3)
144229 100 µg

BCL2 (Adenovirus E1B 19kD protein-interacting protein 3, NIP3/BNIP3)

Sign In for Pricing
View Details
PDZD8 Rabbit Polyclonal Antibody (Biotin)
orb2083771 100 µL

PDZD8 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Anti-Human DRD2 Antibody (SAA0772), PerCP
FHD04814 100 Tests

Anti-Human DRD2 Antibody (SAA0772), PerCP

Sign In for Pricing
View Details
IRAK4 Antibody Blocking Peptide
orb1505984 500 µg

IRAK4 Antibody Blocking Peptide

Sign In for Pricing
View Details
Vaccinia Virus (Smallpox, VACV, VV, Lister Strain) discontinued
V0500-04 1 mL

Vaccinia Virus (Smallpox, VACV, VV, Lister Strain) discontinued

Sign In for Pricing
View Details
HDAC8 Rabbit mAb
MBS9470053-01 0.05 mL

HDAC8 Rabbit mAb

Sign In for Pricing
View Details