Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Inhibin alpha chain (INHA)

This Recombinant Human Inhibin alpha chain (INHA) spans the amino acid sequence from region 233-366. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Inhibin alpha chain INHA

UniProt

P05111

Expression Region

233-366

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

STPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIPPNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLTQHCACI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp872 ORF Vector (Mouse) (pORF)
51166014 1.0 µg DNA

Zfp872 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
HIWI Double Nickase Plasmid (m2)
sc-425423-NIC-2 20 µg

HIWI Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
DYNC1I1 Adenovirus (Human)
18753053 1.0 mL

DYNC1I1 Adenovirus (Human)

Sign In for Pricing
View Details
Mouse Monoclonal CD163 Antibody (6D3.2F3)
NBP2-36495 0.1 mg

Mouse Monoclonal CD163 Antibody (6D3.2F3)

Sign In for Pricing
View Details
ARID5B (AT Rich interactive Domain 5B (MRF1-like), DESRT, FLJ21150, MRF2) (MaxLight 750)
MBS6237239-01 0.1 mL

ARID5B (AT Rich interactive Domain 5B (MRF1-like), DESRT, FLJ21150, MRF2) (MaxLight 750)

Sign In for Pricing
View Details
ARID5B (AT Rich interactive Domain 5B (MRF1-like), DESRT, FLJ21150, MRF2) (MaxLight 750)
MBS6237239-02 5x 0.1 mL

ARID5B (AT Rich interactive Domain 5B (MRF1-like), DESRT, FLJ21150, MRF2) (MaxLight 750)

Sign In for Pricing
View Details