Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fatty acid-binding protein, heart (FABPH)

This Recombinant Human Fatty acid-binding protein, heart (FABPH) spans the amino acid sequence from region 2-133. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fatty acid-binding protein, heart; Fatty acid-binding protein 3; Heart-type fatty acid-binding protein; H-FABP; Mammary-derived growth inhibitor; MDGI; Muscle fatty acid-binding protein; M-FABP; FABP3 FABP11 MDGI

UniProt

P05413

Expression Region

2-133

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAMTS15 Antibody
MBS9411033-01 0.1 mL

ADAMTS15 Antibody

Sign In for Pricing
View Details
ADAMTS15 Antibody
MBS9411033-02 5x 0.1 mL

ADAMTS15 Antibody

Sign In for Pricing
View Details
2-Benzyloxy-5-nitrobenzenethiol
sc-209097 50 mg

2-Benzyloxy-5-nitrobenzenethiol

Sign In for Pricing
View Details
Chmp1b Rat shRNA Plasmid (Locus ID 689364)
TL708019 1 Kit

Chmp1b Rat shRNA Plasmid (Locus ID 689364)

Sign In for Pricing
View Details
Sialic Acid Binding Ig Like Lectin 10 (SIGLEC10) Magnetic Luminex Assay Kit
LKU604571 96 Tests

Sialic Acid Binding Ig Like Lectin 10 (SIGLEC10) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
Clec12b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3685507 1.0 µg DNA

Clec12b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details