Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fatty acid-binding protein, heart (FABPH)

This Recombinant Human Fatty acid-binding protein, heart (FABPH) spans the amino acid sequence from region 2-133. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fatty acid-binding protein, heart; Fatty acid-binding protein 3; Heart-type fatty acid-binding protein; H-FABP; Mammary-derived growth inhibitor; MDGI; Muscle fatty acid-binding protein; M-FABP; FABP3 FABP11 MDGI

UniProt

P05413

Expression Region

2-133

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

58K Golgi protein (N-Term) /FTCD, Biotinylated Antibody
orb389367 100 µg

58K Golgi protein (N-Term) /FTCD, Biotinylated Antibody

Sign In for Pricing
View Details
RANGE EXLI  - Lithium battery fire extinguisher 9L
EX9LI each

RANGE EXLI - Lithium battery fire extinguisher 9L

Sign In for Pricing
View Details
CDC25A Antibody - N-terminal region
MBS3201948-01 0.1 mL

CDC25A Antibody - N-terminal region

Sign In for Pricing
View Details
CDC25A Antibody - N-terminal region
MBS3201948-02 5x 0.1 mL

CDC25A Antibody - N-terminal region

Sign In for Pricing
View Details
Recombinant Mouse Poly (rC)-binding protein 4 (Pcbp4)
MBS954360-01 0.02 mg (E-Coli)

Recombinant Mouse Poly (rC)-binding protein 4 (Pcbp4)

Sign In for Pricing
View Details
Recombinant Mouse Poly (rC)-binding protein 4 (Pcbp4)
MBS954360-02 0.02 mg (Yeast)

Recombinant Mouse Poly (rC)-binding protein 4 (Pcbp4)

Sign In for Pricing
View Details