Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein SETSIP (SETLP)

This Recombinant Human Protein SETSIP (SETLP) spans the amino acid sequence from region 1-292. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein SETSIP; SET pseudogene protein 18; SET similar protein; Similar to SET translocation protein; SETSIP SETP18

UniProt

P0DME0

Expression Region

1-292

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAPKRQSPLPLQKKKPRPPPALGLEETSASAGLPKKGEKEQQEAIEHIDEVQNEIDRLNEQDSEEILKVEQKYNKLRQPFFQKRSELIAKIPNFGVTTFVNHPQVSSLLGEEDEEALHYLTKVEVTEFEDIKSGYRIDFYFDENPYFENKVFSKEFHLNESGDPSSKSTKIKWKSGKDVTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELEEVIKDDIWPNPLQYYLVPDMDDEEGGEDDDDDDDDGDEGEEELEDIDEGDEDEGEEDEDDDEGEEGEEDEGEDD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPATC1 Protein Lysate
OCOA18782-20UG 20 µg

SPATC1 Protein Lysate

Sign In for Pricing
View Details
AUTS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV719532 1.0 µg DNA

AUTS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Recombinant Human TSHR, GST-tagged
TSHR-3450H 25 µg

Recombinant Human TSHR, GST-tagged

Sign In for Pricing
View Details
Lentiviral mouse Camk2n2 shRNA (UAS) - Lentiviral mouse Camk2n2 shRNA (UAS, GFP) (100)
GTR15285501 1 Vial

Lentiviral mouse Camk2n2 shRNA (UAS) - Lentiviral mouse Camk2n2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Mouse CA14 shRNA Plasmid
abx973517-01 150 µg

Mouse CA14 shRNA Plasmid

Sign In for Pricing
View Details
Mouse CA14 shRNA Plasmid
abx973517-02 300 µg

Mouse CA14 shRNA Plasmid

Sign In for Pricing
View Details