Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein SETSIP (SETLP)

This Recombinant Human Protein SETSIP (SETLP) spans the amino acid sequence from region 1-292. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein SETSIP; SET pseudogene protein 18; SET similar protein; Similar to SET translocation protein; SETSIP SETP18

UniProt

P0DME0

Expression Region

1-292

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAPKRQSPLPLQKKKPRPPPALGLEETSASAGLPKKGEKEQQEAIEHIDEVQNEIDRLNEQDSEEILKVEQKYNKLRQPFFQKRSELIAKIPNFGVTTFVNHPQVSSLLGEEDEEALHYLTKVEVTEFEDIKSGYRIDFYFDENPYFENKVFSKEFHLNESGDPSSKSTKIKWKSGKDVTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELEEVIKDDIWPNPLQYYLVPDMDDEEGGEDDDDDDDDGDEGEEELEDIDEGDEDEGEEDEDDDEGEEGEEDEGEDD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr16 siRNA Oligos set (Rat)
34069176 3x 5 nmol

Olr16 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Bovine Chemokine Like Factor Superfamily 5 ELISA Kit
MBS012577-01 48 Well

Bovine Chemokine Like Factor Superfamily 5 ELISA Kit

Sign In for Pricing
View Details
Bovine Chemokine Like Factor Superfamily 5 ELISA Kit
MBS012577-02 96 Well

Bovine Chemokine Like Factor Superfamily 5 ELISA Kit

Sign In for Pricing
View Details
Bovine Chemokine Like Factor Superfamily 5 ELISA Kit
MBS012577-03 5x 96 Well

Bovine Chemokine Like Factor Superfamily 5 ELISA Kit

Sign In for Pricing
View Details
Bovine Chemokine Like Factor Superfamily 5 ELISA Kit
MBS012577-04 10x 96 Well

Bovine Chemokine Like Factor Superfamily 5 ELISA Kit

Sign In for Pricing
View Details
Cd96 (NM_032465) Mouse Tagged Lenti ORF Clone
MR209314L3 10 µg

Cd96 (NM_032465) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details