Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein SETSIP (SETLP)

This Recombinant Human Protein SETSIP (SETLP) spans the amino acid sequence from region 1-292. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein SETSIP; SET pseudogene protein 18; SET similar protein; Similar to SET translocation protein; SETSIP SETP18

UniProt

P0DME0

Expression Region

1-292

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAPKRQSPLPLQKKKPRPPPALGLEETSASAGLPKKGEKEQQEAIEHIDEVQNEIDRLNEQDSEEILKVEQKYNKLRQPFFQKRSELIAKIPNFGVTTFVNHPQVSSLLGEEDEEALHYLTKVEVTEFEDIKSGYRIDFYFDENPYFENKVFSKEFHLNESGDPSSKSTKIKWKSGKDVTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELEEVIKDDIWPNPLQYYLVPDMDDEEGGEDDDDDDDDGDEGEEELEDIDEGDEDEGEEDEDDDEGEEGEEDEGEDD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SLC35E1 Antibody
NBP2-56944 100 µL

Rabbit Polyclonal SLC35E1 Antibody

Sign In for Pricing
View Details
ZNF584 3'UTR Luciferase Stable Cell Line
TU029283 1.0 mL

ZNF584 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
APBB2 Antibody - middle region : FITC (ARP55624_P050-FITC)
ARP55624_P050-FITC 100 µL

APBB2 Antibody - middle region : FITC (ARP55624_P050-FITC)

Sign In for Pricing
View Details
Zfp438 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
50975066 1.0 µg DNA

Zfp438 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Mouse Crsp2 (BC065072) AAV Particle
MR210557A1V 250 µL

Mouse Crsp2 (BC065072) AAV Particle

Sign In for Pricing
View Details
Anti-Dopachrome Tautomerase (DCT) Polyclonal antibody
FY-AB36365-01 1 mL

Anti-Dopachrome Tautomerase (DCT) Polyclonal antibody

Sign In for Pricing
View Details