Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane domain-containing protein TMIGD3 (TMIG3), partial

This Recombinant Human Transmembrane domain-containing protein TMIGD3 (TMIG3), partial spans the amino acid sequence from region 76-212. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane domain-containing protein TMIGD3 TMIGD3 UNQ1931/PRO4406

UniProt

P0DMS9

Expression Region

76-212

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDEKVKRSFVLDTASAICNYNAHYKNHPKYWCRGYFRDYCNIIAFSPNSTNHVALRDTGNQLIVTMSCLTKEDTGWYWCGIQRDFARDDMDFTELIVTDDKGTLANDFWSGKDLSGNKTRSCKAPKVVRKADRSRTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Isopropyl-N'-phenylbenzene-1,4-diamine
TRC-N247745-1G 1 g

N-Isopropyl-N'-phenylbenzene-1,4-diamine

Sign In for Pricing
View Details
TLR9 Human Gene Knockout Kit (CRISPR)
KN207510 1 Kit

TLR9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
11a-Hydroxy Progesterone
TRC-H952335-5G 5 g

11a-Hydroxy Progesterone

Sign In for Pricing
View Details
FGD1 Rabbit Polyclonal Antibody
TA376214 100 µL

FGD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
QuantiChrom™ α-Amylase Assay Kit
DAMY2-100 100 Tests

QuantiChrom™ α-Amylase Assay Kit

Sign In for Pricing
View Details
STAT1 Rabbit Polyclonal Antibody
TA382086 100 µL

STAT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details