Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda constant 2 (IGLC2)

This Recombinant Human Immunoglobulin lambda constant 2 (IGLC2) spans the amino acid sequence from region 1-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda constant 2; Ig lambda chain C region Kern; Ig lambda chain C region NIG-64; Ig lambda chain C region SH; Ig lambda chain C region X; Ig lambda-2 chain C region; IGLC2

UniProt

P0DOY2

Expression Region

1-106

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-493-5p miRNA Antagomir
orb1916066-01 10 nmol

Hsa-miR-493-5p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-493-5p miRNA Antagomir
orb1916066-02 20 nmol

Hsa-miR-493-5p miRNA Antagomir

Sign In for Pricing
View Details
Acrp30 (Adipocyte Complement-related Protein of 30kD, Adiponectin, AdipoQ, apM1, Gelatin Binding Protein 28, GPB28) (MaxLight 490)
A0725-02L-ML490 100 µL

Acrp30 (Adipocyte Complement-related Protein of 30kD, Adiponectin, AdipoQ, apM1, Gelatin Binding Protein 28, GPB28) (MaxLight 490)

Sign In for Pricing
View Details
Recombinant Macaca mulatta Mamu class II histocompatibility antigen, DR alpha chain (Mamu-DRA), partial
MBS1455913-01 0.5 mg (E-Coli)

Recombinant Macaca mulatta Mamu class II histocompatibility antigen, DR alpha chain (Mamu-DRA), partial

Sign In for Pricing
View Details
Recombinant Macaca mulatta Mamu class II histocompatibility antigen, DR alpha chain (Mamu-DRA), partial
MBS1455913-02 0.05 mg (Baculovirus)

Recombinant Macaca mulatta Mamu class II histocompatibility antigen, DR alpha chain (Mamu-DRA), partial

Sign In for Pricing
View Details
Recombinant Macaca mulatta Mamu class II histocompatibility antigen, DR alpha chain (Mamu-DRA), partial
MBS1455913-03 0.5 mg (Yeast)

Recombinant Macaca mulatta Mamu class II histocompatibility antigen, DR alpha chain (Mamu-DRA), partial

Sign In for Pricing
View Details