Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda constant 2 (IGLC2)

This Recombinant Human Immunoglobulin lambda constant 2 (IGLC2) spans the amino acid sequence from region 1-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda constant 2; Ig lambda chain C region Kern; Ig lambda chain C region NIG-64; Ig lambda chain C region SH; Ig lambda chain C region X; Ig lambda-2 chain C region; IGLC2

UniProt

P0DOY2

Expression Region

1-106

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Amino-4,6-dichloropyrimidine
FA11123-01 100 g

5-Amino-4,6-dichloropyrimidine

Sign In for Pricing
View Details
5-Amino-4,6-dichloropyrimidine
FA11123-02 250 g

5-Amino-4,6-dichloropyrimidine

Sign In for Pricing
View Details
5-Amino-4,6-dichloropyrimidine
FA11123-03 500 g

5-Amino-4,6-dichloropyrimidine

Sign In for Pricing
View Details
P2RX3, CT (P2RX3, P2X purinoceptor 3, ATP receptor, Purinergic receptor) (PE) discontinued
039577-PE 200 µL

P2RX3, CT (P2RX3, P2X purinoceptor 3, ATP receptor, Purinergic receptor) (PE) discontinued

Sign In for Pricing
View Details
AHI1 (Jouberin, Abelson Helper integration Site 1 Protein Homolog, AHI-1, AHI1) (MaxLight 405) discontinued
302255-ML405 100 µL

AHI1 (Jouberin, Abelson Helper integration Site 1 Protein Homolog, AHI-1, AHI1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
AHCY (S-adenosylhomocysteine Hydrolase, SAHH) (HRP)
MBS6179591-01 0.1 mL

AHCY (S-adenosylhomocysteine Hydrolase, SAHH) (HRP)

Sign In for Pricing
View Details