Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda constant 2 (IGLC2)

This Recombinant Human Immunoglobulin lambda constant 2 (IGLC2) spans the amino acid sequence from region 1-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda constant 2; Ig lambda chain C region Kern; Ig lambda chain C region NIG-64; Ig lambda chain C region SH; Ig lambda chain C region X; Ig lambda-2 chain C region; IGLC2

UniProt

P0DOY2

Expression Region

1-106

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PROSER3 Antibody Picoband®, Dylight550 Conjugate
A16383-1-Dylight550 100 µg

Anti-PROSER3 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
IMPDH2 antibody (FITC)
60R-1393 0.1 mg

IMPDH2 antibody (FITC)

Sign In for Pricing
View Details
DEFB132 CRISPR All-in-one AAV vector set (with saCas9)(Human)
17955151 3x 1.0 µg DNA

DEFB132 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Recombinant Rhesus Macaque DHX16 Protein, His (Fc)-Avi-tagged
DHX16-1087R 50 µg

Recombinant Rhesus Macaque DHX16 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Mouse Monoclonal TrkB Antibody (72509) [PE/Atto594]
FAB3971PEATT594 0.1 mL

Mouse Monoclonal TrkB Antibody (72509) [PE/Atto594]

Sign In for Pricing
View Details
Geniposide
T2212-01 25 mg

Geniposide

Sign In for Pricing
View Details