Recombinant Human Immunoglobulin lambda constant 3 (IGLC3)
This Recombinant Human Immunoglobulin lambda constant 3 (IGLC3) spans the amino acid sequence from region 1-106. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Immunoglobulin lambda constant 3; Ig lambda chain C region DOT; Ig lambda chain C region NEWM; Ig lambda-3 chain C regions; IGLC3
UniProt
P0DOY3
Expression Region
1-106
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15289183 1 Vial
Lentiviral mouse Ifna15 shRNA (UAS) - Lentiviral mouse Ifna15 shRNA (UAS) plasmid
Sign In for Pricing
View Details 
MSN-H522a-1mg 1 mg
Human Mesothelin / MSLN (296-580) Protein, His Tag, premium grade
Sign In for Pricing
View Details 
A00687-1-Dylight488 100 µg
Anti-Egr1 Antibody Picoband® (Dylight488 Conjugate)
Sign In for Pricing
View Details