Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Secreted Ly-6/uPAR domain-containing protein 2 (SLUR2)

This Recombinant Human Secreted Ly-6/uPAR domain-containing protein 2 (SLUR2) spans the amino acid sequence from region 23-97. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Secreted Ly-6/uPAR domain-containing protein 2; Secreted LY6/PLAUR domain-containing protein 2; Secreted Ly-6/uPAR-related protein 2; SLURP-2; SLURP2

UniProt

P0DP57

Expression Region

23-97

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

IWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCSK1N Human
OM305593-01 2 µg

PCSK1N Human

Sign In for Pricing
View Details
PCSK1N Human
OM305593-02 10 µg

PCSK1N Human

Sign In for Pricing
View Details
PCSK1N Human
OM305593-03 100 µg

PCSK1N Human

Sign In for Pricing
View Details
Rat Tril (TLR4 interactor with leucine rich repeats) ELISA Kit
ER0520 96 Tests

Rat Tril (TLR4 interactor with leucine rich repeats) ELISA Kit

Sign In for Pricing
View Details
CD8 alpha Antibody (Rabbit)
HY-P81148-01 20 µL

CD8 alpha Antibody (Rabbit)

Sign In for Pricing
View Details
CD8 alpha Antibody (Rabbit)
HY-P81148-02 50 μL

CD8 alpha Antibody (Rabbit)

Sign In for Pricing
View Details