Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small nuclear ribonucleoprotein-associated proteins B and B' (RSMB)

This Recombinant Human Small nuclear ribonucleoprotein-associated proteins B and B' (RSMB) spans the amino acid sequence from region 1-240. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small nuclear ribonucleoprotein-associated proteins B and B'; snRNP-B; Sm protein B/B'; Sm-B/B'; SmB/B'; SNRPB COD SNRPB1

UniProt

P14678

Expression Region

1-240

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Crebbp Mouse Gene Knockout Kit (CRISPR)
KN303812LP 1 Kit

Crebbp Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
JWH-398
TRC-J211900-5MG 5 mg

JWH-398

Sign In for Pricing
View Details
APC Anti-Mouse CD206/MMR Antibody[C068C2]
E-AB-F1135E-01 50 Tests

APC Anti-Mouse CD206/MMR Antibody[C068C2]

Sign In for Pricing
View Details
APC Anti-Mouse CD206/MMR Antibody[C068C2]
E-AB-F1135E-02 100 Tests

APC Anti-Mouse CD206/MMR Antibody[C068C2]

Sign In for Pricing
View Details
APC Anti-Mouse CD206/MMR Antibody[C068C2]
E-AB-F1135E-03 2x 100 Tests

APC Anti-Mouse CD206/MMR Antibody[C068C2]

Sign In for Pricing
View Details
MET Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E6]
TA805795AM 100 µL

MET Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E6]

Sign In for Pricing
View Details