Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha (PDE6A), partial

This Recombinant Human Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha (PDE6A), partial spans the amino acid sequence from region 483-816. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha; GMP-PDE alpha; EC 3.1.4.35; PDE V-B1; PDE6A PDEA

UniProt

P16499

Expression Region

483-816

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EEEELAEILQAELPDADKYEINKFHFSDLPLTELELVKCGIQMYYELKVVDKFHIPQEALVRFMYSLSKGYRKITYHNWRHGFNVGQTMFSLLVTGKLKRYFTDLEALAMVTAAFCHDIDHRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKTLLRDESLNIFQNLNRRQHEHAIHMMDIAIIATDLALYFKKRTMFQKIVDQSKTYESEQEWTQYMMLEQTRKEIVMAMMMTACDLSAITKPWEVQSQVALLVAAEFWEQGDLERTVLQQNPIPMMDRNKADELPKLQVGFIDFVCTFVYKEFSRFHEEITPMLDGITNNRKEWKALADEY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C20orf118 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0335905 3x 1.0 µg

C20orf118 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
TBC1D5 Human Pre-designed siRNA Set A
HY-RS14245 1 Set

TBC1D5 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
PLEC Protein (N-His, Human)
P507197 100 µg

PLEC Protein (N-His, Human)

Sign In for Pricing
View Details
Bobcat339 hydrochloride
LXD74744-01 25 mg

Bobcat339 hydrochloride

Sign In for Pricing
View Details
Bobcat339 hydrochloride
LXD74744-02 50 mg

Bobcat339 hydrochloride

Sign In for Pricing
View Details
Bobcat339 hydrochloride
LXD74744-03 100 mg

Bobcat339 hydrochloride

Sign In for Pricing
View Details