Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Azurocidin (CAP7)

This Recombinant Human Azurocidin (CAP7) spans the amino acid sequence from region 27-248. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Azurocidin; Cationic antimicrobial protein CAP37; Heparin-binding protein; HBP; hHBP; AZU1

UniProt

P20160

Expression Region

27-248

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNNPGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD3 ε/CD3E (C-Fc)
CP19-1mg 1 mg

Recombinant Human CD3 ε/CD3E (C-Fc)

Sign In for Pricing
View Details
SATB1 Rabbit mAb
58572 50 µL

SATB1 Rabbit mAb

Sign In for Pricing
View Details
SAMD4A CRISPR Activation Plasmid (h)
sc-406449-ACT 20 µg

SAMD4A CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Erythrinin F
MBS5787576 Inquire

Erythrinin F

Sign In for Pricing
View Details
TRNAI29P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2495407 1.0 µg DNA

TRNAI29P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Cyclin E1 Polyclonal Antibody
RA20592-01 50 µL

Cyclin E1 Polyclonal Antibody

Sign In for Pricing
View Details