Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pro-adrenomedullin (ADML), partial

This Recombinant Human Pro-adrenomedullin (ADML), partial spans the amino acid sequence from region 95-146. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pro-adrenomedullin [Cleaved into: Adrenomedullin; AM; Proadrenomedullin N-20 terminal peptide; ProAM N-terminal 20 peptide; PAMP; ProAM-N20] ADM AM

UniProt

P35318

Expression Region

95-146

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-6502-5p miRNA Mimic
MCH03314 2x 2.5 nmol

hsa-miR-6502-5p miRNA Mimic

Sign In for Pricing
View Details
Siglec-5 (h) : 293T Lysate
sc-114461 100 µg - 200 µL

Siglec-5 (h) : 293T Lysate

Sign In for Pricing
View Details
SPOCK2 Mouse Monoclonal Antibody [Clone ID: LBI1C10]
AMM19944V 100 µL

SPOCK2 Mouse Monoclonal Antibody [Clone ID: LBI1C10]

Sign In for Pricing
View Details
Ephrin A5 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-6048R-BF488 100 µL

Ephrin A5 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Anti-Integrin beta 1 Rabbit Monoclonal Antibody
MBS179448-01 0.03 mL

Anti-Integrin beta 1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Integrin beta 1 Rabbit Monoclonal Antibody
MBS179448-02 0.1 mL

Anti-Integrin beta 1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details