Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mucin-5AC (MUC5A), partial

This Recombinant Human Mucin-5AC (MUC5A), partial spans the amino acid sequence from region 4919-5103. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mucin-5AC; MUC-5AC; Gastric mucin; Major airway glycoprotein; Mucin-5 subtype AC, tracheobronchial; Tracheobronchial mucin; TBM; MUC5AC MUC5

UniProt

P98088

Expression Region

4919-5103

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQIVPVYGHFRVLVDNYFCGAEDGLSCPRSIILEYHQDRVVLTRKPVHGVMTNEIIFNNKVVSPGFRKNGIVVSRIGVKMYATIPELGVQVMFSGLIFSVEVPFSKFANNTEGQCGTCTNDRKDECRTPRGTVVASCSEMSGLWNVSIPDQPACH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cnksr1 siRNA Oligos set (Rat)
16461176 3x 5 nmol

Cnksr1 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
PLK4 (NM_014264) Human Over-expression Lysate
LS010733-20ug 20 µg

PLK4 (NM_014264) Human Over-expression Lysate

Sign In for Pricing
View Details
OPN Antibody
MBS857835-01 0.1 mL

OPN Antibody

Sign In for Pricing
View Details
OPN Antibody
MBS857835-02 0.1 mL (AF405L)

OPN Antibody

Sign In for Pricing
View Details
OPN Antibody
MBS857835-03 0.1 mL (AF405S)

OPN Antibody

Sign In for Pricing
View Details
OPN Antibody
MBS857835-04 0.1 mL (AF610)

OPN Antibody

Sign In for Pricing
View Details