Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Solute carrier family 25 member 3 (S25A3), partial

This Recombinant Human Solute carrier family 25 member 3 (S25A3), partial spans the amino acid sequence from region 87-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Solute carrier family 25 member 3; Phosphate carrier protein, mitochondrial; Phosphate transport protein; PTP; SLC25A3 PHC OK/SW-cl.48

UniProt

Q00325

Expression Region

87-121

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (NM_000611) Human Over-expression Lysate
LC424608 20 µg

CD59 (NM_000611) Human Over-expression Lysate

Sign In for Pricing
View Details
5Alpha-Androstenone
TRC-A637775-5MG 5 mg

5Alpha-Androstenone

Sign In for Pricing
View Details
Phloroglucinol Dihydrate
TRC-P340005-10G 10 g

Phloroglucinol Dihydrate

Sign In for Pricing
View Details
DYKDDDDK Epitope Tag Mouse Monoclonal Antibody [Clone ID: 29E4.G7.H11]
AM08434PU-N 100 µg

DYKDDDDK Epitope Tag Mouse Monoclonal Antibody [Clone ID: 29E4.G7.H11]

Sign In for Pricing
View Details
Brox Mouse Gene Knockout Kit (CRISPR)
KN502273 1 Kit

Brox Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/2340R), CF488A conjugate, 0.1mg/mL
BNC882340-100 1x 100 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/2340R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details