Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cyclin-dependent kinase 6 (CDK6)

This Recombinant Human Cyclin-dependent kinase 6 (CDK6) spans the amino acid sequence from region 1-326. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cyclin-dependent kinase 6; EC 2.7.11.22; Cell division protein kinase 6; Serine/threonine-protein kinase PLSTIRE; CDK6 CDKN6

UniProt

Q00534

Expression Region

1-326

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Anti-Phosphatidyl Serine IgG / IgM ELISA Kit
DEIA1816 96T

Human Anti-Phosphatidyl Serine IgG / IgM ELISA Kit

Sign In for Pricing
View Details
GPR177 Rabbit Polyclonal Antibody (FITC)
orb462534 100 µL

GPR177 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Rat CaM kinase like vesicle associated protein (CAMKV) ELISA kit
GTR10462633 96 Well

Rat CaM kinase like vesicle associated protein (CAMKV) ELISA kit

Sign In for Pricing
View Details
21-Methyltetracosanoyl-CoA
TYD-02443-01 10 mg

21-Methyltetracosanoyl-CoA

Sign In for Pricing
View Details
21-Methyltetracosanoyl-CoA
TYD-02443-02 50 mg

21-Methyltetracosanoyl-CoA

Sign In for Pricing
View Details
Mouse Monoclonal Calreticulin Antibody (1G6A7) [Alexa Fluor 647]
NBP1-47518AF647 0.1 mL

Mouse Monoclonal Calreticulin Antibody (1G6A7) [Alexa Fluor 647]

Sign In for Pricing
View Details