Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Receptor expression-enhancing protein 5 (REEP5), partial

This Recombinant Human Receptor expression-enhancing protein 5 (REEP5), partial spans the amino acid sequence from region 124-189. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Receptor expression-enhancing protein 5; Polyposis locus protein 1; Protein TB2; REEP5 C5orf18 DP1 TB2

UniProt

Q00765

Expression Region

124-189

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Wap, Kazal, Immunoglobulin, Kunitz And Ntr Domain-Containing Protein 2 (Wfikkn2) Elisa Kit
EKC36053 96 Tests

Human Wap, Kazal, Immunoglobulin, Kunitz And Ntr Domain-Containing Protein 2 (Wfikkn2) Elisa Kit

Sign In for Pricing
View Details
Lentiviral human ATP13A4 shRNA (UAS) - Lentiviral human ATP13A4 shRNA (UAS) plasmid
GTR15163147 1 Vial

Lentiviral human ATP13A4 shRNA (UAS) - Lentiviral human ATP13A4 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Chicken Vascular endothelial growth factor receptor 1 (FLT1) ELISA Kit
MBS7245640-01 48 Well

Chicken Vascular endothelial growth factor receptor 1 (FLT1) ELISA Kit

Sign In for Pricing
View Details
Chicken Vascular endothelial growth factor receptor 1 (FLT1) ELISA Kit
MBS7245640-02 96 Well

Chicken Vascular endothelial growth factor receptor 1 (FLT1) ELISA Kit

Sign In for Pricing
View Details
Chicken Vascular endothelial growth factor receptor 1 (FLT1) ELISA Kit
MBS7245640-03 5x 96 Well

Chicken Vascular endothelial growth factor receptor 1 (FLT1) ELISA Kit

Sign In for Pricing
View Details
Chicken Vascular endothelial growth factor receptor 1 (FLT1) ELISA Kit
MBS7245640-04 10x 96 Well

Chicken Vascular endothelial growth factor receptor 1 (FLT1) ELISA Kit

Sign In for Pricing
View Details