Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Receptor expression-enhancing protein 5 (REEP5), partial

This Recombinant Human Receptor expression-enhancing protein 5 (REEP5), partial spans the amino acid sequence from region 124-189. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Receptor expression-enhancing protein 5; Polyposis locus protein 1; Protein TB2; REEP5 C5orf18 DP1 TB2

UniProt

Q00765

Expression Region

124-189

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPLIN (LIMA1) Mouse Monoclonal Antibody [Clone ID: OTI7H8]
CF808587 100 µg

EPLIN (LIMA1) Mouse Monoclonal Antibody [Clone ID: OTI7H8]

Sign In for Pricing
View Details
IFI16 (Interferon, gamma-Inducible Protein 16, IFNGIP1, MGC9466, PYHIN2) (HRP)
247400-HRP 100 µL

IFI16 (Interferon, gamma-Inducible Protein 16, IFNGIP1, MGC9466, PYHIN2) (HRP)

Sign In for Pricing
View Details
Cinp (NM_001106758) Rat Tagged Lenti ORF Clone
RR215457L3 10 µg

Cinp (NM_001106758) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
cfaE Antibody
A50709-50UG 50 µg

cfaE Antibody

Sign In for Pricing
View Details
Lentiviral human SLC7A8 sgRNA gene knockout kit - Lentiviral human SLC7A8 sgRNA gene knockout kit (plasmid)
GTR15354133 1 Vial

Lentiviral human SLC7A8 sgRNA gene knockout kit - Lentiviral human SLC7A8 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
GluR-2 (Phospho-Tyr876) Polyclonal Antibody
E11-121227 100 µL

GluR-2 (Phospho-Tyr876) Polyclonal Antibody

Sign In for Pricing
View Details