Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Receptor expression-enhancing protein 5 (REEP5), partial

This Recombinant Human Receptor expression-enhancing protein 5 (REEP5), partial spans the amino acid sequence from region 124-189. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Receptor expression-enhancing protein 5; Polyposis locus protein 1; Protein TB2; REEP5 C5orf18 DP1 TB2

UniProt

Q00765

Expression Region

124-189

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C15orf29 siRNA Oligos set (Human)
13880171 3x 5 nmol

C15orf29 siRNA Oligos set (Human)

Sign In for Pricing
View Details
GATA-3 (HG3-35) Alexa Fluor® 647
sc-269 AF647 200 µg/mL

GATA-3 (HG3-35) Alexa Fluor® 647

Sign In for Pricing
View Details
Polystyrene AM HMBA
H16020014.100G 100 g

Polystyrene AM HMBA

Sign In for Pricing
View Details
Mouse Monoclonal PDGFRL Antibody (1008804) [PE/Cy7]
FAB1723PECY7 0.1 mL

Mouse Monoclonal PDGFRL Antibody (1008804) [PE/Cy7]

Sign In for Pricing
View Details
GSK3A Protein Vector (Human) (pPM-C-HA)
22735021 500 ng

GSK3A Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral mouse Atoh1 shRNA (UAS) - Lentiviral mouse Atoh1 shRNA (UAS, RFP) plasmid
GTR15213841 1 Vial

Lentiviral mouse Atoh1 shRNA (UAS) - Lentiviral mouse Atoh1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details