Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myosin-binding protein C, slow-type (MYPC1), partial

This Recombinant Human Myosin-binding protein C, slow-type (MYPC1), partial spans the amino acid sequence from region 722-833. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Myosin-binding protein C, slow-type; Slow MyBP-C; C-protein, skeletal muscle slow isoform; MYBPC1 MYBPCS

UniProt

Q00872

Expression Region

722-833

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

TLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse PPARG Protein, N-His
bs-106538P-01 20 µg

Recombinant Mouse PPARG Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse PPARG Protein, N-His
bs-106538P-02 50 µg

Recombinant Mouse PPARG Protein, N-His

Sign In for Pricing
View Details
VAV1 Knockout Cell Lysate
ABC-KC2294 100 µg

VAV1 Knockout Cell Lysate

Sign In for Pricing
View Details
Human NTM/Neurotrimin ELISA Kit
E1803Hu 96 Tests

Human NTM/Neurotrimin ELISA Kit

Sign In for Pricing
View Details
Choactase (h) -PR
sc-41919-PR 10 µM - 20 µL

Choactase (h) -PR

Sign In for Pricing
View Details
GSK3β Mouse Monoclonal Antibody (4D2)
E12-603 100 µg -100 µL

GSK3β Mouse Monoclonal Antibody (4D2)

Sign In for Pricing
View Details