Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium channel protein type 7 subunit alpha (SCN7A), partial

This Recombinant Human Sodium channel protein type 7 subunit alpha (SCN7A), partial spans the amino acid sequence from region 260-338. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium channel protein type 7 subunit alpha; Atypical sodium channel Nav2.1; Nax channel; Sodium channel protein type VII subunit alpha; SCN7A SCN6A

UniProt

Q01118

Expression Region

260-338

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGNLKHKCFRWPQENENETLHNRTGNPYYIRETENFYYLEGERYALLCGNRTDAGQCPEGYVCVKAGINPDQGFTNFDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Klk5 shRNA (UAS) - Lentiviral mouse Klk5 shRNA (UAS, iRFP) (25)
GTR15204638 1 Vial

Lentiviral mouse Klk5 shRNA (UAS) - Lentiviral mouse Klk5 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
IL2R beta Recombinant Antibody [5H4]
OAAV01142-200UG 200 µg

IL2R beta Recombinant Antibody [5H4]

Sign In for Pricing
View Details
TLCD1 siRNA (m)
sc-154290 10 µM

TLCD1 siRNA (m)

Sign In for Pricing
View Details
Recombinant Thermosynechococcus elongatus Cytochrome b6-f complex subunit 4 (petD)
MBS1044858 Inquire

Recombinant Thermosynechococcus elongatus Cytochrome b6-f complex subunit 4 (petD)

Sign In for Pricing
View Details
ROAA Antibody
MBS9603967-01 0.1 mL

ROAA Antibody

Sign In for Pricing
View Details
ROAA Antibody
MBS9603967-02 0.2 mL

ROAA Antibody

Sign In for Pricing
View Details