Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human OTU domain-containing protein 4 (OTUD4), partial

This Recombinant Human OTU domain-containing protein 4 (OTUD4), partial spans the amino acid sequence from region 34-155. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

OTU domain-containing protein 4; EC 3.4.19.12; HIV-1-induced protein HIN-1; OTUD4 HIN-1 KIAA1046

UniProt

Q01804

Expression Region

34-155

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LYRKLVAKDGSCLFRAVAEQVLHSQSRHVEVRMACIHYLRENREKFEAFIEGSFEEYLKRLENPQEWVGQVEISALSLMYRKDFIIYREPNVSPSQVTENNFPEKVLLCFSNGNHYDIVYPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIGLEC8 Goat Polyclonal Antibody
TA305896 100 µg

SIGLEC8 Goat Polyclonal Antibody

Sign In for Pricing
View Details
UBAP2 Antibody
A52564-50UL 50 μL

UBAP2 Antibody

Sign In for Pricing
View Details
Lentiviral mouse Gba shRNA (UAS) - Lentiviral mouse Gba shRNA (UAS, RFP) plasmid
GTR15277969 1 Vial

Lentiviral mouse Gba shRNA (UAS) - Lentiviral mouse Gba shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Factor VIII (Coagulation Factor VIII, FVIII, F8 Protein, F8B, F8C, Antihemophilic Factor, AHF, Dxs1253e, HEMA, Procoagulant Component) APC
MBS6136520-01 0.1 mL

Factor VIII (Coagulation Factor VIII, FVIII, F8 Protein, F8B, F8C, Antihemophilic Factor, AHF, Dxs1253e, HEMA, Procoagulant Component) APC

Sign In for Pricing
View Details
Factor VIII (Coagulation Factor VIII, FVIII, F8 Protein, F8B, F8C, Antihemophilic Factor, AHF, Dxs1253e, HEMA, Procoagulant Component) APC
MBS6136520-02 5x 0.1 mL

Factor VIII (Coagulation Factor VIII, FVIII, F8 Protein, F8B, F8C, Antihemophilic Factor, AHF, Dxs1253e, HEMA, Procoagulant Component) APC

Sign In for Pricing
View Details
Mouse Monoclonal RXR beta/NR2B2 Antibody (PCRP-RXRB-2B6) [DyLight 680]
NBP3-08445FR 100 µL

Mouse Monoclonal RXR beta/NR2B2 Antibody (PCRP-RXRB-2B6) [DyLight 680]

Sign In for Pricing
View Details