Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein kinase C epsilon type (KPCE)

This Recombinant Human Protein kinase C epsilon type (KPCE) spans the amino acid sequence from region 1-737. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein kinase C epsilon type; EC 2.7.11.13; nPKC-epsilon; PRKCE PKCE

UniProt

Q02156

Expression Region

1-737

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKTNSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLEPEGRVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQPTYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDQVGSQRFSVNMPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIAKVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELENNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKRLGLDEFNFIKVLGKGSFGKVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLDAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGEDAIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQINQEEFKGFSYFGEDLMP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JNK1 (MAPK8) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B4H9]
TA500276AM 100 µL

JNK1 (MAPK8) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B4H9]

Sign In for Pricing
View Details
NAGA Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8H7]
TA811279AM 100 µL

NAGA Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8H7]

Sign In for Pricing
View Details
Naled
TRC-N245300-1G 1 g

Naled

Sign In for Pricing
View Details
Mouse Cdh6 activation kit by CRISPRa
GA200666 1 Kit

Mouse Cdh6 activation kit by CRISPRa

Sign In for Pricing
View Details
Nucleolar / Nucleoli (NM95), CF647 conjugate, 0.1mg/mL
BNC470095-500 1x 500 µL

Nucleolar / Nucleoli (NM95), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pyruvate Kinase (PKLR) Mouse Monoclonal Antibody [Clone ID: AT1E3]
AM09397PU-N 100 µL

Pyruvate Kinase (PKLR) Mouse Monoclonal Antibody [Clone ID: AT1E3]

Sign In for Pricing
View Details