Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome c oxidase subunit 6A2, mitochondrial (CX6A2), partial

This Recombinant Human Cytochrome c oxidase subunit 6A2, mitochondrial (CX6A2), partial spans the amino acid sequence from region 50-97. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 6A2, mitochondrial; Cytochrome c oxidase polypeptide VIa-heart; COXVIAH; Cytochrome c oxidase subunit VIA-muscle; COX VIa-M; COX6A2 COX6A COX6AH

UniProt

Q02221

Expression Region

50-97

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HSGHRPRPEFRPYQHLRIRTKPYPWGDGNHTLFHNSHVNPLPTGYEHP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 (122.2), CF740 conjugate, 0.1mg/mL
BNC740175-100 1x 100 µL

CD46 (122.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF740 conjugate, 0.1mg/mL
BNC740977-100 1x 100 µL

TGF-beta (1D11.16.8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF488A conjugate, 0.1mg/mL
BNC880305-500 1x 500 µL

CD95 (B-R18), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL
BNC680679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL
BNC740226-500 1x 500 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (TFRC/1149), CF568 conjugate, 0.1mg/mL
BNC681149-500 1x 500 µL

CD71 (TFRC/1149), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details