Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Helix-loop-helix protein 2 (HEN2)

This Recombinant Human Helix-loop-helix protein 2 (HEN2) spans the amino acid sequence from region 1-135. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Helix-loop-helix protein 2; HEN-2; Class A basic helix-loop-helix protein 34; bHLHa34; Nescient helix loop helix 2; NSCL-2; NHLH2 BHLHA34 HEN2 KIAA0490

UniProt

Q02577

Expression Region

1-135

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MMLSPDQAADSDHPSSAHSDPESLGGTDTKVLGSVSDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPGR1 Rabbit Polyclonal Antibody
JOT-AP04540-01 20 µL

RPGR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RPGR1 Rabbit Polyclonal Antibody
JOT-AP04540-02 50 μL

RPGR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RPGR1 Rabbit Polyclonal Antibody
JOT-AP04540-03 100 µL

RPGR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HOXC13 Antibody Blocking peptide
orb1453798 500 µg

HOXC13 Antibody Blocking peptide

Sign In for Pricing
View Details
Rabbit anti-MRPS27 Antibody
MBS4504733-01 0.05 mL

Rabbit anti-MRPS27 Antibody

Sign In for Pricing
View Details
Rabbit anti-MRPS27 Antibody
MBS4504733-02 0.1 mL

Rabbit anti-MRPS27 Antibody

Sign In for Pricing
View Details