Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Helix-loop-helix protein 2 (HEN2)

This Recombinant Human Helix-loop-helix protein 2 (HEN2) spans the amino acid sequence from region 1-135. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Helix-loop-helix protein 2; HEN-2; Class A basic helix-loop-helix protein 34; bHLHa34; Nescient helix loop helix 2; NSCL-2; NHLH2 BHLHA34 HEN2 KIAA0490

UniProt

Q02577

Expression Region

1-135

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MMLSPDQAADSDHPSSAHSDPESLGGTDTKVLGSVSDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-tert-Butyl-2-hydroxybenzaldehyde
sc-226184 5 g

3-tert-Butyl-2-hydroxybenzaldehyde

Sign In for Pricing
View Details
FGG 293 Cell Lysate
400250 0.1 mg

FGG 293 Cell Lysate

Sign In for Pricing
View Details
MRPL41 siRNA (Rat)
CRR4464-01 15 nmol

MRPL41 siRNA (Rat)

Sign In for Pricing
View Details
MRPL41 siRNA (Rat)
CRR4464-02 30 nmol

MRPL41 siRNA (Rat)

Sign In for Pricing
View Details
RPN1 (Ribophorin I) (15M5) Mouse Monoclonal antibody
E28PE1787 100 µL

RPN1 (Ribophorin I) (15M5) Mouse Monoclonal antibody

Sign In for Pricing
View Details
Anti-Dulaglutide ELISA Kit
AW328028 96 Tests

Anti-Dulaglutide ELISA Kit

Sign In for Pricing
View Details