Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 1,4-alpha-glucan-branching enzyme (GLGB)

This Recombinant Human 1,4-alpha-glucan-branching enzyme (GLGB) spans the amino acid sequence from region 2-702. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

1,4-alpha-glucan-branching enzyme; EC 2.4.1.18; Brancher enzyme; Glycogen-branching enzyme; GBE1

UniProt

Q04446

Expression Region

2-702

Origin

Homo sapiens (Human)

Field of Research

Protein Biochemistry

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AAPMTPAARPEDYEAALNAALADVPELARLLEIDPYLKPYAVDFQRRYKQFSQILKNIGENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVPHGSKLKVVITSKSGEILYRISPWAKYVVREGDNVNYDWIHWDPEHSYEFKHSRPKKPRSLRIYESHVGISSHEGKVASYKHFTCNVLPRIKGLGYNCIQLMAIMEHAYYASFGYQITSFFAASSRYGTPEELQELVDTAHSMGIIVLLDVVHSHASKNSADGLNMFDGTDSCYFHSGPRGTHDLWDSRLFAYSSWEILRFLLSNIRWWLEEYRFDGFRFDGVTSMLYHHHGVGQGFSGDYSEYFGLQVDEDALTYLMLANHLVHTLCPDSITIAEDVSGMPALCSPISQGGGGFDYRLAMAIPDKWIQLLKEFKDEDWNMGDIVYTLTNRRYLEKCIAYAESHDQALVGDKSLAFWLMDAEMYTNMSVLTPFTPVIDRGIQLHKMIRLITHGLGGEGYLNFMGNEFGHPEWLDFPRKGNNESYHYARRQFHLTDDDLLRYKFLNNFDRDMNRLEERYGWLAAPQAYVSEKHEGNKIIAFERAGLLFIFNFHPSKSYTDYRVGTALPGKFKIVLDSDAAEYGGHQRLDHSTDFFSEAFEHNGRPYSLLVYIPSRVALILQNVDLPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Firmonertinib (mesylate)
HY-112870A-01 5 mg

Firmonertinib (mesylate)

Sign In for Pricing
View Details
Firmonertinib (mesylate)
HY-112870A-02 10 mg

Firmonertinib (mesylate)

Sign In for Pricing
View Details
Firmonertinib (mesylate)
HY-112870A-03 25 mg

Firmonertinib (mesylate)

Sign In for Pricing
View Details
Firmonertinib (mesylate)
HY-112870A-04 50 mg

Firmonertinib (mesylate)

Sign In for Pricing
View Details
Firmonertinib (mesylate)
HY-112870A-05 100 mg

Firmonertinib (mesylate)

Sign In for Pricing
View Details
Firmonertinib (mesylate)
HY-112870A-06 500 mg

Firmonertinib (mesylate)

Sign In for Pricing
View Details