Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human P protein (P), partial

This Recombinant Human P protein (P), partial spans the amino acid sequence from region 198-330. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P protein; Melanocyte-specific transporter protein; Pink-eyed dilution protein homolog; OCA2 D15S12 P

UniProt

Q04671

Expression Region

198-330

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PDQGKLWQLLALSPLENYSVNLSSHVDSTLLQVDLAGALVASGPSRPGREEHIVVELTQADALGSRWRRPQQVTHNWTVYLNPRRSEHSVMSRTFEVLTRETVSISIRASLQQTQAVPLLMAHQYLRGSVETQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ME1 Antibody Picoband® Fluoro594 Conjugated
A03449-3-Fluoro594 100 µg/Vial

Anti-ME1 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
Sheep Annexin III (ANX III) ELISA Kit
GTR10340897 96 Well

Sheep Annexin III (ANX III) ELISA Kit

Sign In for Pricing
View Details
C21orf54 CRISPR All-in-one AAV vector set (with saCas9)(Human)
14341151 3x 1.0 µg DNA

C21orf54 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
2- (Benzyloxy) -4-bromo-6-methylaniline
OR1095035-01 250 mg

2- (Benzyloxy) -4-bromo-6-methylaniline

Sign In for Pricing
View Details
2- (Benzyloxy) -4-bromo-6-methylaniline
OR1095035-02 500 mg

2- (Benzyloxy) -4-bromo-6-methylaniline

Sign In for Pricing
View Details
2- (Benzyloxy) -4-bromo-6-methylaniline
OR1095035-03 1 g

2- (Benzyloxy) -4-bromo-6-methylaniline

Sign In for Pricing
View Details