Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human P protein (P), partial

This Recombinant Human P protein (P), partial spans the amino acid sequence from region 198-330. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P protein; Melanocyte-specific transporter protein; Pink-eyed dilution protein homolog; OCA2 D15S12 P

UniProt

Q04671

Expression Region

198-330

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PDQGKLWQLLALSPLENYSVNLSSHVDSTLLQVDLAGALVASGPSRPGREEHIVVELTQADALGSRWRRPQQVTHNWTVYLNPRRSEHSVMSRTFEVLTRETVSISIRASLQQTQAVPLLMAHQYLRGSVETQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HighYield T7 P&L RNA Synthesis Kit
RNT-201 50 reactions x 20 μl

HighYield T7 P&L RNA Synthesis Kit

Sign In for Pricing
View Details
Human ITGb6 ELISA Kit
orb440311-01 48 Tests

Human ITGb6 ELISA Kit

Sign In for Pricing
View Details
Human ITGb6 ELISA Kit
orb440311-02 96 Tests

Human ITGb6 ELISA Kit

Sign In for Pricing
View Details
Tetrachloroterephthaloyl chloride 95%
T02905-01 5 g

Tetrachloroterephthaloyl chloride 95%

Sign In for Pricing
View Details
Tetrachloroterephthaloyl chloride 95%
T02905-02 25 g

Tetrachloroterephthaloyl chloride 95%

Sign In for Pricing
View Details
Tetrachloroterephthaloyl chloride 95%
T02905-03 100 g

Tetrachloroterephthaloyl chloride 95%

Sign In for Pricing
View Details