Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Activin receptor type-1 (ACVR1), partial

This Recombinant Human Activin receptor type-1 (ACVR1), partial spans the amino acid sequence from region 21-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Activin receptor type-1; EC 2.7.11.30; Activin receptor type I; ACTR-I; Activin receptor-like kinase 2; ALK-2; Serine/threonine-protein kinase receptor R1; SKR1; TGF-B superfamily receptor type I; TSR-I; ACVR1 ACVRLK2

UniProt

Q04771

Expression Region

21-123

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXA1 (Forkhead Box A1, HNF3A, MGC33105, TCF3A) (MaxLight 550)
246257-ML550 100 µL

FOXA1 (Forkhead Box A1, HNF3A, MGC33105, TCF3A) (MaxLight 550)

Sign In for Pricing
View Details
5-Methoxy-2- (trifluoromethyl) pyridine
orb3031509-01 100 mg

5-Methoxy-2- (trifluoromethyl) pyridine

Sign In for Pricing
View Details
5-Methoxy-2- (trifluoromethyl) pyridine
orb3031509-02 2 mg

5-Methoxy-2- (trifluoromethyl) pyridine

Sign In for Pricing
View Details
5-Methoxy-2- (trifluoromethyl) pyridine
orb3031509-03 10 mg

5-Methoxy-2- (trifluoromethyl) pyridine

Sign In for Pricing
View Details
Imidazo[2,1-b][1,3]thiazole-2-carboxylic acid hydrochloride
JRA06293-01 0.5 g

Imidazo[2,1-b][1,3]thiazole-2-carboxylic acid hydrochloride

Sign In for Pricing
View Details
Imidazo[2,1-b][1,3]thiazole-2-carboxylic acid hydrochloride
JRA06293-02 5 g

Imidazo[2,1-b][1,3]thiazole-2-carboxylic acid hydrochloride

Sign In for Pricing
View Details