Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Activin receptor type-1 (ACVR1), partial

This Recombinant Human Activin receptor type-1 (ACVR1), partial spans the amino acid sequence from region 21-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Activin receptor type-1; EC 2.7.11.30; Activin receptor type I; ACTR-I; Activin receptor-like kinase 2; ALK-2; Serine/threonine-protein kinase receptor R1; SKR1; TGF-B superfamily receptor type I; TSR-I; ACVR1 ACVRLK2

UniProt

Q04771

Expression Region

21-123

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DTWD2 Recombinant Protein (Mouse)
RP130178 100 µg

DTWD2 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Donkey Macrophage-Stimulating Protein Receptor (MST1R) ELISA Kit
MBS9921572 Inquire

Donkey Macrophage-Stimulating Protein Receptor (MST1R) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal ARHGAP27 Antibody
NBP1-91223-25ul 25 µL

Rabbit Polyclonal ARHGAP27 Antibody

Sign In for Pricing
View Details
AS1938909
HY-18284 1 Each

AS1938909

Sign In for Pricing
View Details
NEK9 Antibody (Phospho-Thr210) : HRP (OAAF07637-HRP)
OAAF07637-100UG-HRP 100 µg

NEK9 Antibody (Phospho-Thr210) : HRP (OAAF07637-HRP)

Sign In for Pricing
View Details
Lentiviral mouse Lce1a2 shRNA (UAS) - Lentiviral mouse Lce1a2 shRNA (UAS, GFP) plasmid
GTR15183298 1 Vial

Lentiviral mouse Lce1a2 shRNA (UAS) - Lentiviral mouse Lce1a2 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details