Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Activin receptor type-1 (ACVR1), partial

This Recombinant Human Activin receptor type-1 (ACVR1), partial spans the amino acid sequence from region 21-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Activin receptor type-1; EC 2.7.11.30; Activin receptor type I; ACTR-I; Activin receptor-like kinase 2; ALK-2; Serine/threonine-protein kinase receptor R1; SKR1; TGF-B superfamily receptor type I; TSR-I; ACVR1 ACVRLK2

UniProt

Q04771

Expression Region

21-123

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR2C2 Rabbit Monoclonal Antibody [Clone ID: 24GB730]
TA425018 100 µL

NR2C2 Rabbit Monoclonal Antibody [Clone ID: 24GB730]

Sign In for Pricing
View Details
Zfp87 (NM_133228) Mouse Tagged ORF Clone
MG208628 10 µg

Zfp87 (NM_133228) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ACAD-10 Double Nickase Plasmid (m)
sc-428177-NIC 20 µg

ACAD-10 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
SS18L2 siRNA (Mouse)
MBS8211136-01 15 nmol

SS18L2 siRNA (Mouse)

Sign In for Pricing
View Details
SS18L2 siRNA (Mouse)
MBS8211136-02 30 nmol

SS18L2 siRNA (Mouse)

Sign In for Pricing
View Details
SS18L2 siRNA (Mouse)
MBS8211136-03 5x 30 nmol

SS18L2 siRNA (Mouse)

Sign In for Pricing
View Details