Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sialomucin core protein 24 (MUC24), partial

This Recombinant Human Sialomucin core protein 24 (MUC24), partial spans the amino acid sequence from region 24-162. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sialomucin core protein 24; MUC-24; Endolyn; Multi-glycosylated core protein 24; MGC-24; MGC-24v; CD antigen CD164; CD164

UniProt

Q04900

Expression Region

24-162

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (Cris-1), CF647 conjugate, 0.1mg/mL
BNC470176-500 1x 500 µL

CD5 (Cris-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL
BNC742848-500 1x 500 µL

Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF594 conjugate, 0.1mg/mL
BNC941052-100 1x 100 µL

CD3e (B-B12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL
BNC880034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF594 conjugate, 0.1mg/mL
BNC940043-100 1x 100 µL

P21 / WAF1 (WA-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2428), CF405S conjugate, 0.1mg/mL
BNC042428-100 1x 100 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2428), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details