Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sialomucin core protein 24 (MUC24), partial

This Recombinant Human Sialomucin core protein 24 (MUC24), partial spans the amino acid sequence from region 24-162. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sialomucin core protein 24; MUC-24; Endolyn; Multi-glycosylated core protein 24; MGC-24; MGC-24v; CD antigen CD164; CD164

UniProt

Q04900

Expression Region

24-162

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FMR1NB Protein Vector (Mouse) (pPB-C-His)
PV179854 500 ng

FMR1NB Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
IL-22RA2 Antibody
orb1423730 100 µL

IL-22RA2 Antibody

Sign In for Pricing
View Details
OSCP1 (NM_145047) Human Over-expression Lysate
LS127700 100 µg

OSCP1 (NM_145047) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human TGFBR2 (C-Fc)
PHH1625-01 10 µg

Recombinant Human TGFBR2 (C-Fc)

Sign In for Pricing
View Details
Recombinant Human TGFBR2 (C-Fc)
PHH1625-02 50 µg

Recombinant Human TGFBR2 (C-Fc)

Sign In for Pricing
View Details
Recombinant Human TGFBR2 (C-Fc)
PHH1625-03 500 µg

Recombinant Human TGFBR2 (C-Fc)

Sign In for Pricing
View Details