Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Galectin-10 (LEG10)

This Recombinant Human Galectin-10 (LEG10) spans the amino acid sequence from region 2-142. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Galectin-10; Gal-10; Charcot-Leyden crystal protein; CLC; Eosinophil lysophospholipase; Lysolecithin acylhydrolase; CLC LGALS10 LGALS10A

UniProt

Q05315

Expression Region

2-142

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lymph node
CS800111 5x 5 µm

Tissue FFPE Sections, Lymph node

Sign In for Pricing
View Details
Tissue FFPE Sections, Myometrium
CS800083 5x 5 µm

Tissue FFPE Sections, Myometrium

Sign In for Pricing
View Details
Recombinant Clusterin/Apolipoprotein J/Apo-J/CLU Monoclonal Antibody
AN300046P 100 µL

Recombinant Clusterin/Apolipoprotein J/Apo-J/CLU Monoclonal Antibody

Sign In for Pricing
View Details
Rabeprazole-d3 Sodium Salt
TRC-R070503-1MG 1 mg

Rabeprazole-d3 Sodium Salt

Sign In for Pricing
View Details
Influenza A H5N1 Mouse Monoclonal Antibody [Clone ID: AT2B7]
AM39074PU-N 100 µL

Influenza A H5N1 Mouse Monoclonal Antibody [Clone ID: AT2B7]

Sign In for Pricing
View Details
Mouse Ddx4 activation kit by CRISPRa
GA201047 1 Kit

Mouse Ddx4 activation kit by CRISPRa

Sign In for Pricing
View Details