Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sulfotransferase 2A1 (ST2A1)

This Recombinant Human Sulfotransferase 2A1 (ST2A1) spans the amino acid sequence from region 1-285. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sulfotransferase 2A1; ST2A1; EC 2.8.2.2; Bile salt sulfotransferase; EC 2.8.2.14; Dehydroepiandrosterone sulfotransferase; DHEA-ST; DHEA-ST8; Hydroxysteroid Sulfotransferase; HST; ST2; SULT2A3; SULT2A1 HST STD

UniProt

Q06520

Expression Region

1-285

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant BAT3 Antibody
RC-16276-01 50 μL

Recombinant BAT3 Antibody

Sign In for Pricing
View Details
Recombinant BAT3 Antibody
RC-16276-02 100 µL

Recombinant BAT3 Antibody

Sign In for Pricing
View Details
Recombinant BAT3 Antibody
RC-16276-03 1 mL

Recombinant BAT3 Antibody

Sign In for Pricing
View Details
1,1'-[(2-Hydroxyethyl)imino]bis-2-propanol
TRC-H375540-1G 1 g

1,1'-[(2-Hydroxyethyl)imino]bis-2-propanol

Sign In for Pricing
View Details
CHRDL1 (NM_001143983) Human Over-expression Lysate
LC428443 20 µg

CHRDL1 (NM_001143983) Human Over-expression Lysate

Sign In for Pricing
View Details
NGFR (Nerve Growth Factor Receptor) (NGFR5), CF405S conjugate, 0.1mg/mL
BNC040890-500 1x 500 µL

NGFR (Nerve Growth Factor Receptor) (NGFR5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details